Skip to content

NEW  Coming soon: ask your fleet a question and get an answer — an MCP server for AI.  Read more →

2026-09-05 · UTC

Internet weather report

A daily read on the public networks the remote.it fleet connects over —
Saturday, September 5, 2026, worldwide. Global internet: operating normally.

Not a remote.it status page — we measure the local networks our devices connect over. “Stormy” means the internet there is running well below what an always-on connection should deliver.

Today's outlook

Four forecasts, one fleet.

Internet health, 0–100 — scored on always-on devices, where every drop is real.

Cellular
LTE / 4G / 5G
95 internet health
7-day history
Always-on
52%
Avg uptime
99.5%
Fleet
50k+
Time online
68.0%
Starlink
LEO satellite
98 internet health
7-day history
Always-on
60%
Avg uptime
99.4%
Fleet
10k+
Time online
76.8%
Broadband
Cable · DSL · fiber
98 internet health
7-day history
Always-on
81%
Avg uptime
99.5%
Fleet
50k+
Time online
87.5%
This week

The last seven days.

One point per day. The bands are the fleet's daily grade mix — that's where its weekday/weekend rhythm shows — while the health line holds to the always-on standard.

5075100☀️Sun☀️Mon☀️Tue☀️Wed☀️Thu☀️Fri☀️Today
Global Internet Health · Last 7 Days
DateInternet healthFleet mixTime onlineConditions
Sunday, August 309888/7/590.6%Clear
Monday, August 319788/7/690.0%Clear
Tuesday, September 19779/11/1073.0%Clear
Wednesday, September 29778/11/1074.4%Clear
Thursday, September 39778/12/1075.8%Clear
Friday, September 49778/12/1076.7%Clear
Saturday, September 59779/11/978.8%Clear
World

Internet health by country.

Shaded by internet health. Grey means no reporting fleet today.

Simple World MapAuthor: Al MacDonald Editor: Fritz Lekschas License: CC BY-SA 3.0 ID: ISO 3166-1 or "_[a-zA-Z]" if an ISO code is not available
60 100 No data internet health
Networks
1 Japan +1.5 vs normal 100 7.0 7-day fleet-score change -7.0 pts · range 86–95 C S B
2 Switzerland -3.0 vs normal 100 29.0 7-day fleet-score change -29.0 pts · range 67–96 C S B
3 Belgium -1.0 vs normal 100 17.0 7-day fleet-score change -17.0 pts · range 70–92 C S B
4 Ireland 0.0 vs normal 100 13.0 7-day fleet-score change -13.0 pts · range 59–87 C S B
5 Czechia -1.0 vs normal 100 13.0 7-day fleet-score change -13.0 pts · range 74–91 C S B
6 Iceland +1.0 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 81–86 C B
7 South Korea -1.0 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 81–86 C B
8 Guatemala 0.0 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 96–99 C S B
9 Vietnam -1.5 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 89–94 C B
10 Romania -2.0 vs normal 100 12.0 7-day fleet-score change -12.0 pts · range 70–86 C B
11 Latvia +1.0 vs normal 100 14.0 7-day fleet-score change -14.0 pts · range 66–100 C B
12 Hungary -2.0 vs normal 100 9.0 7-day fleet-score change -9.0 pts · range 88–98 C B
13 Slovenia +1.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 96–98 C B
14 Bulgaria +1.0 vs normal 100 4.0 7-day fleet-score change -4.0 pts · range 78–86 C S B
15 Malta -1.5 vs normal 100 6.0 7-day fleet-score change -6.0 pts · range 80–93 C B
16 Egypt +3.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 81–87 C B
17 Iran +11.5 vs normal 100 4.0 7-day fleet-score change -4.0 pts · range 53–91 C B
18 Bolivia +2.0 vs normal 100 3.0 7-day fleet-score change +3.0 pts · range 89–98 C S B
19 Faroe Islands -0.5 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 71–74 C
20 Costa Rica -1.0 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 89–94 S B
21 El Salvador -3.5 vs normal 100 5.0 7-day fleet-score change -5.0 pts · range 92–98 C B
22 Dominican Republic -1.5 vs normal 100 5.0 7-day fleet-score change -5.0 pts · range 71–81 C S B
23 Maldives -2.5 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 89–93 C B
24 Belarus 0.0 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 95–98 C B
25 Serbia -4.5 vs normal 100 9.0 7-day fleet-score change -9.0 pts · range 52–97 C B
26 Puerto Rico -3.5 vs normal 100 4.0 7-day fleet-score change -4.0 pts · range 92–98 S B
27 Cambodia 0.0 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 89–96 B
28 Kuwait -3.0 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 90–93 C B
29 Paraguay -6.0 vs normal 100 11.0 7-day fleet-score change -11.0 pts · range 70–81 B
30 Senegal +9.0 vs normal 100 13.0 7-day fleet-score change +13.0 pts · range 65–88 C
31 Uruguay +15.5 vs normal 100 7.0 7-day fleet-score change +7.0 pts · range 62–87 B
32 Jordan -0.5 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 95–99 C B
33 Nepal +2.5 vs normal 100 7.0 7-day fleet-score change +7.0 pts · range 93–100 B
34 Côte d’Ivoire +6.5 vs normal 100 8.0 7-day fleet-score change +8.0 pts · range 81–91 C B
35 Qatar +2.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts · range 90–98 C B
36 Mongolia +7.5 vs normal 100 6.0 7-day fleet-score change +6.0 pts · range 87–95 C B
37 Bahamas 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts B
38 Nicaragua -1.0 vs normal 100 1.0 7-day fleet-score change +1.0 pts · range 61–90 C S B
39 Sri Lanka +3.5 vs normal 100 4.0 7-day fleet-score change +4.0 pts · range 77–90 B
40 Guyana +12.5 vs normal 100 16.0 7-day fleet-score change +16.0 pts · range 62–78 S B
41 Oman -1.0 vs normal 100 5.0 7-day fleet-score change +5.0 pts · range 87–97 C B
42 Honduras -4.0 vs normal 100 3.0 7-day fleet-score change +3.0 pts · range 75–91 S B
43 Bahrain 0.0 vs normal 100 7.0 7-day fleet-score change +7.0 pts · range 90–100 C B
44 Tonga 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts C
45 Mauritius +6.5 vs normal 100 10.0 7-day fleet-score change +10.0 pts · range 65–78 C B
46 Uganda +0.5 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 87–95 B
47 Kazakhstan -11.0 vs normal 100 20.0 7-day fleet-score change -20.0 pts · range 69–91 C B
48 U.S. Virgin Islands 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts S B
49 Azerbaijan +7.0 vs normal 100 8.0 7-day fleet-score change +8.0 pts · range 59–67 B
50 French Polynesia 0.0 vs normal 100 0.0 7-day fleet-score change +0.0 pts B
51 Brunei 100 19.0 7-day fleet-score change -19.0 pts · range 76–95 B
52 Georgia +6.5 vs normal 100 2.0 7-day fleet-score change +2.0 pts · range 93–100 C B
53 Australia -1.5 vs normal 99 8.0 7-day fleet-score change -8.0 pts · range 63–71 C S B
54 Germany 0.0 vs normal 99 17.0 7-day fleet-score change -17.0 pts · range 75–95 C S B
55 Sweden +2.0 vs normal 99 12.0 7-day fleet-score change -12.0 pts · range 81–97 C S B
56 Austria 0.0 vs normal 99 20.0 7-day fleet-score change -20.0 pts · range 66–93 C S B
57 Mexico +1.5 vs normal 99 1.0 7-day fleet-score change +1.0 pts · range 92–95 C S B
58 Poland -1.0 vs normal 99 19.0 7-day fleet-score change -19.0 pts · range 64–90 C S B
59 Norway +0.5 vs normal 99 7.0 7-day fleet-score change -7.0 pts · range 82–97 C S B
60 Denmark +5.5 vs normal 99 13.0 7-day fleet-score change -13.0 pts · range 76–96 C S B
61 Finland 0.0 vs normal 99 9.0 7-day fleet-score change -9.0 pts · range 76–86 C B
62 Luxembourg 0.0 vs normal 99 16.0 7-day fleet-score change -16.0 pts · range 53–90 C B
63 Israel -0.5 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 93–95 C B
64 Lithuania +1.0 vs normal 99 2.0 7-day fleet-score change +2.0 pts · range 56–61 C B
65 Portugal -2.0 vs normal 99 12.0 7-day fleet-score change -12.0 pts · range 80–96 C S B
66 Argentina +4.5 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 81–90 C S B
67 Ecuador 0.0 vs normal 99 17.0 7-day fleet-score change -17.0 pts · range 73–96 C S B
68 Saudi Arabia +6.0 vs normal 99 6.0 7-day fleet-score change +6.0 pts · range 86–93 C B
69 Hong Kong SAR China -1.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 90–96 C B
70 Panama -1.0 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 87–96 S B
71 United States +1.0 vs normal 98 4.0 7-day fleet-score change -4.0 pts · range 89–94 C S B
72 United Kingdom +1.0 vs normal 98 6.0 7-day fleet-score change -6.0 pts · range 88–95 C S B
73 Netherlands 0.0 vs normal 98 11.0 7-day fleet-score change -11.0 pts · range 72–89 C S B
74 Italy +0.5 vs normal 98 7.0 7-day fleet-score change -7.0 pts · range 79–94 C S B
75 Colombia +1.0 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 91–92 C S B
76 France -2.5 vs normal 98 16.0 7-day fleet-score change -16.0 pts · range 75–94 C S B
77 Spain 0.0 vs normal 98 12.0 7-day fleet-score change -12.0 pts · range 68–83 C S B
78 Slovakia -1.0 vs normal 98 3.0 7-day fleet-score change -3.0 pts · range 91–94 C S B
79 Chile 0.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 89–91 C S B
80 Philippines 0.0 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 79–83 C S B
81 Indonesia -2.0 vs normal 98 3.0 7-day fleet-score change -3.0 pts · range 86–91 C S B
82 Malaysia 0.0 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 92–94 C S B
83 South Africa -0.5 vs normal 98 8.0 7-day fleet-score change -8.0 pts · range 77–89 C B
84 Estonia +0.5 vs normal 98 3.0 7-day fleet-score change -3.0 pts · range 85–94 C B
85 Ukraine 0.0 vs normal 98 1.0 7-day fleet-score change +1.0 pts · range 92–93 C S B
86 Greece -4.5 vs normal 98 6.0 7-day fleet-score change -6.0 pts · range 88–94 C S B
87 Taiwan +4.0 vs normal 98 3.0 7-day fleet-score change +3.0 pts · range 90–95 C B
88 Isle of Man -3.5 vs normal 98 5.0 7-day fleet-score change -5.0 pts · range 86–100 C B
89 Cyprus +3.5 vs normal 98 6.0 7-day fleet-score change +6.0 pts · range 91–99 C B
90 Bosnia & Herzegovina -0.5 vs normal 98 2.0 7-day fleet-score change +2.0 pts · range 81–86 C B
91 Tanzania -3.5 vs normal 98 11.0 7-day fleet-score change -11.0 pts · range 74–91 C
92 Canada -0.5 vs normal 97 3.0 7-day fleet-score change -3.0 pts · range 80–85 C S B
93 Peru +2.5 vs normal 97 3.0 7-day fleet-score change +3.0 pts · range 86–92 C S B
94 Jersey -5.5 vs normal 97 11.0 7-day fleet-score change -11.0 pts · range 73–91 B
95 Türkiye -3.0 vs normal 97 2.0 7-day fleet-score change -2.0 pts · range 74–78 C B
96 Croatia +1.5 vs normal 97 2.0 7-day fleet-score change -2.0 pts · range 83–90 C S B
97 Congo - Brazzaville +2.0 vs normal 97 13.0 7-day fleet-score change +13.0 pts · range 80–93 B
98 Thailand -1.0 vs normal 96 2.0 7-day fleet-score change -2.0 pts · range 81–93 C B
99 Brazil -1.0 vs normal 96 2.0 7-day fleet-score change -2.0 pts · range 89–93 C S B
100 Venezuela -2.0 vs normal 96 2.0 7-day fleet-score change -2.0 pts · range 88–91 C S B
101 Guernsey 0.0 vs normal 95 13.0 7-day fleet-score change -13.0 pts · range 68–94 C B
102 Morocco -5.0 vs normal 95 5.0 7-day fleet-score change -5.0 pts · range 82–92 C B
103 Singapore -0.5 vs normal 94 2.0 7-day fleet-score change -2.0 pts · range 86–91 C B
104 New Zealand -1.0 vs normal 94 11.0 7-day fleet-score change -11.0 pts · range 68–83 C S B
105 Nigeria +7.0 vs normal 94 6.0 7-day fleet-score change +6.0 pts · range 70–84 C S B
106 Angola -13.0 vs normal 94 16.0 7-day fleet-score change -16.0 pts · range 43–76 C
107 United Arab Emirates -2.0 vs normal · -5 vs always-on standard 93 3.0 7-day fleet-score change -3.0 pts · range 88–91 C B
108 Pakistan -4.5 vs normal · -5 vs always-on standard 93 6.0 7-day fleet-score change -6.0 pts · range 81–87 C B
109 Papua New Guinea +4.0 vs normal · -6 vs always-on standard 92 2.0 7-day fleet-score change +2.0 pts · range 78–85 C S B
110 Tunisia -3.0 vs normal · -6 vs always-on standard 92 8.0 7-day fleet-score change -8.0 pts · range 49–79 C B
111 Algeria +4.0 vs normal · -6 vs always-on standard 92 7.0 7-day fleet-score change +7.0 pts · range 46–71 C B
112 India +0.5 vs normal · -7 vs always-on standard 91 1.0 7-day fleet-score change +1.0 pts · range 85–87 C B
113 Kenya +0.5 vs normal · -7 vs always-on standard 91 2.0 7-day fleet-score change -2.0 pts · range 81–89 C S B
114 China -1.0 vs normal · -8 vs always-on standard 90 2.0 7-day fleet-score change -2.0 pts · range 81–85 C B
115 Iraq +3.5 vs normal · -9 vs always-on standard 89 0.0 7-day fleet-score change +0.0 pts · range 70–83 C B
116 Ghana +5.5 vs normal · -10 vs always-on standard 88 7.0 7-day fleet-score change +7.0 pts · range 39–66 C
117 Bangladesh +14.5 vs normal · -12 vs always-on standard 86 18.0 7-day fleet-score change +18.0 pts · range 52–74 C B
118 Myanmar (Burma) -4.0 vs normal · -23 vs always-on standard 75 4.0 7-day fleet-score change -4.0 pts · range 51–64 B
119 Russia -2.0 vs normal · -24 vs always-on standard 74 1.0 7-day fleet-score change +1.0 pts · range 41–52 C B
120 Réunion 0.0 vs normal 61 0.0 7-day fleet-score change +0.0 pts · range 61–75 C
121 Greenland +9.5 vs normal 52 6.0 7-day fleet-score change +6.0 pts · range 46–60 C S
United States

Internet health by state.

Shaded by internet health. Territories appear in the table.

TXCAMTNMAZNVCOWYORUTMNIDKSSDNEAKNDOKMOWAGAFLMIILIAWIARALNCNYMSLAPATNOHVAKYINMESCWVMDVTNHMANJHICTDERIDC
60 100 No data internet health
Networks
1 Nebraska +3.0 vs normal 100 5.0 7-day fleet-score change -5.0 pts · range 74–86 C S B
2 Kentucky -1.0 vs normal 100 2.0 7-day fleet-score change -2.0 pts · range 95–97 C S B
3 Oklahoma 0.0 vs normal 100 3.0 7-day fleet-score change -3.0 pts · range 81–94 C S B
4 Maine -0.5 vs normal 100 1.0 7-day fleet-score change -1.0 pts · range 94–98 S B
5 Alaska -1.0 vs normal 100 4.0 7-day fleet-score change +4.0 pts · range 57–72 C S B
6 Wyoming -3.5 vs normal 100 5.0 7-day fleet-score change -5.0 pts · range 74–86 S B
7 South Dakota +1.5 vs normal 100 6.0 7-day fleet-score change -6.0 pts · range 83–97 S B
8 North Dakota +1.0 vs normal 100 13.0 7-day fleet-score change -13.0 pts · range 73–100 B
9 Texas +1.5 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 90–95 C S B
10 California 0.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 94–96 C S B
11 Georgia -0.5 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 87–92 C S B
12 Florida -0.5 vs normal 99 6.0 7-day fleet-score change -6.0 pts · range 88–97 C S B
13 Washington +1.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 93–96 C S B
14 Illinois +0.5 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 84–92 C S B
15 Massachusetts 0.0 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 93–97 C S B
16 North Carolina +2.5 vs normal 99 5.0 7-day fleet-score change -5.0 pts · range 83–94 C S B
17 Ohio +0.5 vs normal 99 16.0 7-day fleet-score change -16.0 pts · range 82–100 C S B
18 Pennsylvania +2.0 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 84–89 C S B
19 Nevada +1.5 vs normal 99 0.0 7-day fleet-score change +0.0 pts · range 89–93 C S B
20 Arizona +2.0 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 87–95 C S B
21 Utah -0.5 vs normal 99 5.0 7-day fleet-score change -5.0 pts · range 83–94 C S B
22 Wisconsin +2.0 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 79–95 C S B
23 South Carolina +1.0 vs normal 99 6.0 7-day fleet-score change -6.0 pts · range 87–95 C S B
24 Michigan -1.5 vs normal 99 10.0 7-day fleet-score change -10.0 pts · range 81–95 C S B
25 Connecticut -1.5 vs normal 99 9.0 7-day fleet-score change -9.0 pts · range 88–99 C S B
26 Missouri +3.5 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 83–95 C S B
27 Idaho +1.0 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 93–97 C S B
28 Hawaii -1.0 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 88–97 C S B
29 Iowa -2.0 vs normal 99 11.0 7-day fleet-score change -11.0 pts · range 79–91 C S B
30 Vermont +0.5 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 94–97 S B
31 New Hampshire -1.0 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 96–99 S B
32 Montana +1.5 vs normal 99 1.0 7-day fleet-score change -1.0 pts · range 95–98 S B
33 New Mexico +2.5 vs normal 99 3.0 7-day fleet-score change -3.0 pts · range 89–96 C S B
34 West Virginia -2.0 vs normal 99 5.0 7-day fleet-score change -5.0 pts · range 92–98 S B
35 Rhode Island 0.0 vs normal 99 2.0 7-day fleet-score change -2.0 pts · range 93–99 C S B
36 Arkansas +2.0 vs normal 99 4.0 7-day fleet-score change -4.0 pts · range 78–94 C S B
37 Virginia +2.0 vs normal 98 2.0 7-day fleet-score change -2.0 pts · range 86–94 C S B
38 Colorado 0.0 vs normal 98 2.0 7-day fleet-score change -2.0 pts · range 89–94 C S B
39 New York 0.0 vs normal 98 3.0 7-day fleet-score change -3.0 pts · range 90–96 C S B
40 Minnesota +0.5 vs normal 98 7.0 7-day fleet-score change -7.0 pts · range 79–93 C S B
41 New Jersey 0.0 vs normal 98 0.0 7-day fleet-score change +0.0 pts · range 88–89 C S B
42 Tennessee +1.0 vs normal 98 3.0 7-day fleet-score change -3.0 pts · range 85–91 C S B
43 District of Columbia +1.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 84–87 C B
44 Maryland 0.0 vs normal 98 2.0 7-day fleet-score change -2.0 pts · range 91–97 C S B
45 Alabama 0.0 vs normal 98 1.0 7-day fleet-score change -1.0 pts · range 94–97 C S B
46 Kansas -1.5 vs normal 98 5.0 7-day fleet-score change -5.0 pts · range 73–91 C S B
47 Louisiana +1.5 vs normal 98 2.0 7-day fleet-score change -2.0 pts · range 65–95 C S B
48 Mississippi +0.5 vs normal 98 5.0 7-day fleet-score change -5.0 pts · range 72–97 C S B
49 Delaware -1.0 vs normal 98 8.0 7-day fleet-score change -8.0 pts · range 85–99 C S B
50 Indiana +2.5 vs normal 96 0.0 7-day fleet-score change +0.0 pts · range 84–93 C S B
51 Oregon 0.0 vs normal · -6 vs always-on standard 92 0.0 7-day fleet-score change +0.0 pts · range 84–85 C S B

How we grade the weather

We grade a connection by how often it drops while the device is online — reconnects per online-hour — not by raw connectivity, so a device that sleeps to save power isn't punished for being offline by design. Internet health is that grade measured on always-on devices (online 90%+ of the day, where a reconnect is a real drop, never a scheduled wake), scored 0–100. Icons follow that number on one absolute scale — Clear at 95+, Partly cloudy from 85, Stormy below — the same bar everywhere, so “stormy” always means genuinely below standard, never “below its own usual”. A region's movement against its own recent trend is a secondary note, not the weather itself. Groups too small for an always-on cohort report their whole-fleet composite until one exists.

Today, and the last 24 hours

Each report covers the last 24 hours of devices seen — today's active fleet, not a rolling week — so the trend actually moves day to day. Time online counts devices that sleep by design, which is why it undersells the fleet; the honest measure of scale is the always-on share, the portion online 90%+ of the day. That same duty-cycling is the weekday/weekend rhythm you see in the trend bands. We report cellular vs. Starlink as an observed difference, not a verdict — usage and power still color it. And if most regions ever dip at once, we flag the day as a data anomaly instead of a global storm: the internet doesn't fail everywhere simultaneously, but a measurement pipeline can.

Confidence, privacy & sources

The Sample dots show how much data backs a row — a larger sample means a more reliable average (we never publish exact counts). Tables are ordered by the figure shown, with nothing hidden behind it, so a region running on a handful of devices can sit near the top on thin evidence — check its dots before drawing a conclusion. Aggregates only: any region with fewer than 20 devices is omitted, and a network-class row within a region needs at least 5 devices — below that, an “average” is close to one device's raw telemetry; no counts, IPs, or user data are ever published. World map: “Simple World Map” by Al MacDonald / Fritz Lekschas, CC BY-SA 3.0. US geometry: public-domain US Census cartographic boundaries (us-atlas).

Generated 2026-09-05T00:31:27.076Z · powered by remote.it

Search articles